General Information

  • ID:  hor000184
  • Uniprot ID:  O96605
  • Protein name:  Molt-inhibiting hormone
  • Gene name:  MIH
  • Organism:  Charybdis feriata (Crucifix crab) (Cancer feriatus)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Charybdis (genus), Thalamitinae (subfamily), Portunidae (family), Portunoidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RVFNDDCPNLMGNRDLYKKVEWICDDCANIFRIPGMASICRKDCFFNEDFLWCVRATERTEEMMQLKQWVRILGAGRM
  • Length:  78(36-113)
  • Propeptide:  MMSRANSRFSCQRTWLLAVVVLAAIWSSSLHQAAARVFNDDCPNLMGNRDLYKKVEWICDDCANIFRIPGMASICRKDCFFNEDFLWCVRATERTEEMMQLKQWVRILGAGRM
  • Signal peptide:  MMSRANSRFSCQRTWLLAVVVLAAIWSSSLHQAAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  7-44; 24-40; 27-53
  • Structure ID:  AF-O96605-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000184_AF2.pdbhor000184_ESM.pdb

Physical Information

Mass: 1068851 Formula: C406H632N116O114S11
Absent amino acids: H Common amino acids: RD
pI: 6.38 Basic residues: 12
Polar residues: 19 Hydrophobic residues: 26
Hydrophobicity: -32.18 Boman Index: -17193
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 70
Instability Index: 3114.62 Extinction Coefficient cystines: 18365
Absorbance 280nm: 238.51

Literature

  • PubMed ID:  9931416
  • Title:  PCR Cloning and Expression of the Molt-Inhibiting Hormone Gene for the Crab (Charybdis Feriatus)